Name | HEPH antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7345 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | HEPH antibody was raised using the N terminal of HEPH corresponding to a region with amino acids MHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHTAFFHGQMLTTRG |
Purity/Format | Affinity purified |
Blocking Peptide | HEPH Blocking Peptide |
Description | Rabbit polyclonal HEPH antibody raised against the N terminal of HEPH |
Gene | HEPH |
Supplier Page | Shop |