| Name | HEPH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7345 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | HEPH antibody was raised using the N terminal of HEPH corresponding to a region with amino acids MHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHTAFFHGQMLTTRG |
| Purity/Format | Affinity purified |
| Blocking Peptide | HEPH Blocking Peptide |
| Description | Rabbit polyclonal HEPH antibody raised against the N terminal of HEPH |
| Gene | HEPH |
| Supplier Page | Shop |