SLC1A2 antibody

Name SLC1A2 antibody
Supplier Fitzgerald
Catalog 70R-6543
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen SLC1A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM
Purity/Format Affinity purified
Blocking Peptide SLC1A2 Blocking Peptide
Description Rabbit polyclonal SLC1A2 antibody
Gene SLC1A2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.