CYP4X1 antibody

Name CYP4X1 antibody
Supplier Fitzgerald
Catalog 70R-7249
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CYP4X1 antibody was raised using the middle region of CYP4X1 corresponding to a region with amino acids LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP
Purity/Format Affinity purified
Blocking Peptide CYP4X1 Blocking Peptide
Description Rabbit polyclonal CYP4X1 antibody raised against the middle region of CYP4X1
Gene CYP4X1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.