PPP1R11 antibody

Name PPP1R11 antibody
Supplier Fitzgerald
Catalog 70R-3745
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen PPP1R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN
Purity/Format Affinity purified
Blocking Peptide PPP1R11 Blocking Peptide
Description Rabbit polyclonal PPP1R11 antibody
Gene PPP1R11
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.