CRAT antibody

Name CRAT antibody
Supplier Fitzgerald
Catalog 70R-1945
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CRAT antibody was raised using the N terminal of CRAT corresponding to a region with amino acids MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD
Purity/Format Affinity purified
Blocking Peptide CRAT Blocking Peptide
Description Rabbit polyclonal CRAT antibody raised against the N terminal of CRAT
Gene CRAT
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.