| Name | ARF6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5721 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Drosophila |
| Antigen | ARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG |
| Purity/Format | Affinity purified |
| Blocking Peptide | ARF6 Blocking Peptide |
| Description | Rabbit polyclonal ARF6 antibody raised against the middle region of ARF6 |
| Gene | ARF6 |
| Supplier Page | Shop |