| Name | AP1M2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4535 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | AP1M2 antibody was raised using the N terminal of AP1M2 corresponding to a region with amino acids MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | AP1M2 Blocking Peptide |
| Description | Rabbit polyclonal AP1M2 antibody raised against the N terminal of AP1M2 |
| Gene | JUNB |
| Supplier Page | Shop |