| Name | ACVR2B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7464 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ACVR2B antibody was raised using the middle region of ACVR2B corresponding to a region with amino acids LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACVR2B Blocking Peptide |
| Description | Rabbit polyclonal ACVR2B antibody raised against the middle region of ACVR2B |
| Gene | ACVR2B |
| Supplier Page | Shop |