Name | ACVR2B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7464 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ACVR2B antibody was raised using the middle region of ACVR2B corresponding to a region with amino acids LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV |
Purity/Format | Affinity purified |
Blocking Peptide | ACVR2B Blocking Peptide |
Description | Rabbit polyclonal ACVR2B antibody raised against the middle region of ACVR2B |
Gene | ACVR2B |
Supplier Page | Shop |