| Name | OTUD6B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5812 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | OTUD6B antibody was raised using the middle region of OTUD6B corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC |
| Purity/Format | Affinity purified |
| Blocking Peptide | OTUD6B Blocking Peptide |
| Description | Rabbit polyclonal OTUD6B antibody raised against the middle region of OTUD6B |
| Gene | OTUD6B |
| Supplier Page | Shop |