SPATA9 antibody

Name SPATA9 antibody
Supplier Fitzgerald
Catalog 70R-6752
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR
Purity/Format Affinity purified
Blocking Peptide SPATA9 Blocking Peptide
Description Rabbit polyclonal SPATA9 antibody raised against the N terminal of SPATA9
Gene SPATA9
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.