Name | VPREB1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5905 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | VPREB1 antibody was raised using the middle region of VPREB1 corresponding to a region with amino acids TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP |
Purity/Format | Affinity purified |
Blocking Peptide | VPREB1 Blocking Peptide |
Description | Rabbit polyclonal VPREB1 antibody raised against the middle region of VPREB1 |
Gene | IGLL1 |
Supplier Page | Shop |