| Name | VPREB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5905 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | VPREB1 antibody was raised using the middle region of VPREB1 corresponding to a region with amino acids TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP |
| Purity/Format | Affinity purified |
| Blocking Peptide | VPREB1 Blocking Peptide |
| Description | Rabbit polyclonal VPREB1 antibody raised against the middle region of VPREB1 |
| Gene | IGLL1 |
| Supplier Page | Shop |