| Name | TTC9C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3116 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TTC9C antibody was raised using the N terminal of TTC9C corresponding to a region with amino acids MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP |
| Purity/Format | Affinity purified |
| Blocking Peptide | TTC9C Blocking Peptide |
| Description | Rabbit polyclonal TTC9C antibody raised against the N terminal of TTC9C |
| Gene | TTC9C |
| Supplier Page | Shop |