| Name | CDH22 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1834 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CDH22 Blocking Peptide |
| Description | Rabbit polyclonal CDH22 antibody raised against the N terminal of CDH22 |
| Gene | CDH22 |
| Supplier Page | Shop |