ST8SIA2 antibody

Name ST8SIA2 antibody
Supplier Fitzgerald
Catalog 70R-7133
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen ST8SIA2 antibody was raised using the C terminal of ST8SIA2 corresponding to a region with amino acids TGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQAS
Purity/Format Affinity purified
Blocking Peptide ST8SIA2 Blocking Peptide
Description Rabbit polyclonal ST8SIA2 antibody raised against the C terminal of ST8SIA2
Gene ST8SIA2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.