| Name | PPP4C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3051 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PPP4C antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPP4C Blocking Peptide |
| Description | Rabbit polyclonal PPP4C antibody |
| Gene | ANXA5 |
| Supplier Page | Shop |