| Name | Nestin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5230 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Nestin antibody was raised using the middle region of NES corresponding to a region with amino acids LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA |
| Purity/Format | Affinity purified |
| Blocking Peptide | Nestin Blocking Peptide |
| Description | Rabbit polyclonal Nestin antibody raised against the middle region of NES |
| Gene | NES |
| Supplier Page | Shop |