| Name | Nucleobindin 2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1577 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Nucleobindin 2 Blocking Peptide |
| Description | Rabbit polyclonal Nucleobindin 2 antibody raised against the middle region of NUCB2 |
| Gene | NUCB2 |
| Supplier Page | Shop |