| Name | RASGEF1A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5738 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RASGEF1A antibody was raised using the N terminal of RASGEF1A corresponding to a region with amino acids TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | RASGEF1A Blocking Peptide |
| Description | Rabbit polyclonal RASGEF1A antibody raised against the N terminal of RASGEF1A |
| Gene | RASGEF1A |
| Supplier Page | Shop |