Name | TEX264 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7352 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV |
Purity/Format | Affinity purified |
Blocking Peptide | TEX264 Blocking Peptide |
Description | Rabbit polyclonal TEX264 antibody raised against the middle region of TEX264 |
Gene | TEX264 |
Supplier Page | Shop |