Name | KIAA0020 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1443 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | KIAA0020 antibody was raised using the N terminal of KIAA0020 corresponding to a region with amino acids GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | KIAA0020 Blocking Peptide |
Description | Rabbit polyclonal KIAA0020 antibody raised against the N terminal of KIAA0020 |
Gene | KIAA0020 |
Supplier Page | Shop |