RPA1 antibody

Name RPA1 antibody
Supplier Fitzgerald
Catalog 70R-5546
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA
Purity/Format Affinity purified
Blocking Peptide RPA1 Blocking Peptide
Description Rabbit polyclonal RPA1 antibody raised against the middle region of RPA1
Gene RPA1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.