Name | PAFAH1B2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3207 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | PAFAH1B2 antibody was raised using the N terminal of PAFAH1B2 corresponding to a region with amino acids MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV |
Purity/Format | Affinity purified |
Blocking Peptide | PAFAH1B2 Blocking Peptide |
Description | Rabbit polyclonal PAFAH1B2 antibody raised against the N terminal of PAFAH1B2 |
Gene | PAFAH1B2 |
Supplier Page | Shop |