| Name | ACSL4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7155 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ACSL4 antibody was raised using the N terminal of ACSL4 corresponding to a region with amino acids AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACSL4 Blocking Peptide |
| Description | Rabbit polyclonal ACSL4 antibody raised against the N terminal of ACSL4 |
| Gene | ACSL4 |
| Supplier Page | Shop |