TEX264 antibody

Name TEX264 antibody
Supplier Fitzgerald
Catalog 70R-7283
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK
Purity/Format Affinity purified
Blocking Peptide TEX264 Blocking Peptide
Description Rabbit polyclonal TEX264 antibody raised against the middle region of TEX264
Gene TEX264
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.