Name | METTL7A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1021 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat |
Antigen | METTL7A antibody was raised using the N terminal of METTL7A corresponding to a region with amino acids MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | METTL7A Blocking Peptide |
Description | Rabbit polyclonal METTL7A antibody raised against the N terminal of METTL7A |
Gene | METTL7A |
Supplier Page | Shop |