| Name | PIGL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4483 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PIGL antibody was raised using the N terminal of PIGL corresponding to a region with amino acids MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIGL Blocking Peptide |
| Description | Rabbit polyclonal PIGL antibody raised against the N terminal of PIGL |
| Gene | PIGL |
| Supplier Page | Shop |