Name | EFCAB4B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3774 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | EFCAB4B antibody was raised using the N terminal of EFCAB4B corresponding to a region with amino acids ARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQ |
Purity/Format | Affinity purified |
Blocking Peptide | EFCAB4B Blocking Peptide |
Description | Rabbit polyclonal EFCAB4B antibody raised against the N terminal of EFCAB4B |
Gene | CRACR2A |
Supplier Page | Shop |