GABRR1 antibody

Name GABRR1 antibody
Supplier Fitzgerald
Catalog 70R-5215
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GABRR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH
Purity/Format Affinity purified
Blocking Peptide GABRR1 Blocking Peptide
Description Rabbit polyclonal GABRR1 antibody
Gene GABRR1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.