Name | ACMSD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6311 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ACMSD antibody was raised using the middle region of ACMSD corresponding to a region with amino acids NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE |
Purity/Format | Affinity purified |
Blocking Peptide | ACMSD Blocking Peptide |
Description | Rabbit polyclonal ACMSD antibody raised against the middle region of ACMSD |
Gene | ACMSD |
Supplier Page | Shop |