| Name | ACMSD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6311 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ACMSD antibody was raised using the middle region of ACMSD corresponding to a region with amino acids NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACMSD Blocking Peptide |
| Description | Rabbit polyclonal ACMSD antibody raised against the middle region of ACMSD |
| Gene | ACMSD |
| Supplier Page | Shop |