| Name | SPATA2L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3641 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SPATA2L antibody was raised using the middle region of SPATA2L corresponding to a region with amino acids SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLE |
| Purity/Format | Affinity purified |
| Blocking Peptide | SPATA2L Blocking Peptide |
| Description | Rabbit polyclonal SPATA2L antibody raised against the middle region of SPATA2L |
| Gene | SPATA2L |
| Supplier Page | Shop |