| Name | C4BPB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5917 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | C4BPB antibody was raised using the N terminal of C4BPB corresponding to a region with amino acids CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | C4BPB Blocking Peptide |
| Description | Rabbit polyclonal C4BPB antibody raised against the N terminal of C4BPB |
| Gene | C4BPB |
| Supplier Page | Shop |