XRCC5 antibody

Name XRCC5 antibody
Supplier Fitzgerald
Catalog 70R-1235
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen XRCC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM
Purity/Format Total IgG Protein A purified
Blocking Peptide XRCC5 Blocking Peptide
Description Rabbit polyclonal XRCC5 antibody
Gene XRCC5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.