| Name | ARAF antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5718 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ARAF antibody was raised using the middle region of ARAF corresponding to a region with amino acids PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW |
| Purity/Format | Affinity purified |
| Blocking Peptide | ARAF Blocking Peptide |
| Description | Rabbit polyclonal ARAF antibody raised against the middle region of ARAF |
| Gene | ARAF |
| Supplier Page | Shop |