| Name | STK32A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3604 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | STK32A antibody was raised using the N terminal of STK32A corresponding to a region with amino acids GANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAM |
| Purity/Format | Affinity purified |
| Blocking Peptide | STK32A Blocking Peptide |
| Description | Rabbit polyclonal STK32A antibody raised against the N terminal of STK32A |
| Gene | STK32A |
| Supplier Page | Shop |