| Name | NYD-SP21 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6530 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NYD-SP21 antibody was raised using the middle region of Nyd-Sp21 corresponding to a region with amino acids QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV |
| Purity/Format | Affinity purified |
| Blocking Peptide | NYD-SP21 Blocking Peptide |
| Description | Rabbit polyclonal NYD-SP21 antibody raised against the middle region of Nyd-Sp21 |
| Gene | MS4A14 |
| Supplier Page | Shop |