Name | HNRPDL antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1322 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Dog |
Antigen | HNRPDL antibody was raised using the middle region of HNRPDL corresponding to a region with amino acids TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | HNRPDL Blocking Peptide |
Description | Rabbit polyclonal HNRPDL antibody raised against the middle region of HNRPDL |
Gene | HNRNPDL |
Supplier Page | Shop |