| Name | UGCG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7359 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | UGCG antibody was raised using the N terminal of UGCG corresponding to a region with amino acids LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL |
| Purity/Format | Affinity purified |
| Blocking Peptide | UGCG Blocking Peptide |
| Description | Rabbit polyclonal UGCG antibody raised against the N terminal of UGCG |
| Gene | GCLC |
| Supplier Page | Shop |