AChE antibody

Name AChE antibody
Supplier Fitzgerald
Catalog 70R-6077
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV
Purity/Format Affinity purified
Blocking Peptide AChE Blocking Peptide
Description Rabbit polyclonal AChE antibody Yt blood group
Gene ACHE
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.