| Name | SRR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3983 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SRR antibody was raised using the middle region of SRR corresponding to a region with amino acids GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | SRR Blocking Peptide |
| Description | Rabbit polyclonal SRR antibody raised against the middle region of SRR |
| Gene | SRR |
| Supplier Page | Shop |