SMARCD1 antibody

Name SMARCD1 antibody
Supplier Fitzgerald
Catalog 70R-3053
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen SMARCD1 antibody was raised using the middle region of Smarcd1 corresponding to a region with amino acids RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ
Purity/Format Affinity purified
Blocking Peptide SMARCD1 Blocking Peptide
Description Rabbit polyclonal SMARCD1 antibody raised against the middle region of Smarcd1
Gene SMARCD1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.