| Name | TETRAN antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6840 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | TETRAN antibody was raised using the middle region of TETRAN corresponding to a region with amino acids APSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFL |
| Purity/Format | Affinity purified |
| Blocking Peptide | TETRAN Blocking Peptide |
| Description | Rabbit polyclonal TETRAN antibody raised against the middle region of TETRAN |
| Gene | MFSD10 |
| Supplier Page | Shop |