A2BP1 antibody

Name A2BP1 antibody
Supplier Fitzgerald
Catalog 70R-2568
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen A2BP1 antibody was raised using the N terminal of A2BP1 corresponding to a region with amino acids NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE
Purity/Format Affinity purified
Blocking Peptide A2BP1 Blocking Peptide
Description Rabbit polyclonal Ataxin 2-Binding Protein 1 antibody raised against the N terminal of A2BP1
Gene RBFOX1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.