Name | MFNG antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5292 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | MFNG antibody was raised using the C terminal of MFNG corresponding to a region with amino acids QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP |
Purity/Format | Affinity purified |
Blocking Peptide | MFNG Blocking Peptide |
Description | Rabbit polyclonal MFNG antibody raised against the C terminal of MFNG |
Gene | MFNG |
Supplier Page | Shop |