| Name | MFNG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5292 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MFNG antibody was raised using the C terminal of MFNG corresponding to a region with amino acids QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP |
| Purity/Format | Affinity purified |
| Blocking Peptide | MFNG Blocking Peptide |
| Description | Rabbit polyclonal MFNG antibody raised against the C terminal of MFNG |
| Gene | MFNG |
| Supplier Page | Shop |