| Name | EIF3M antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1252 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | EIF3M antibody was raised using the N terminal of EIF3M corresponding to a region with amino acids MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | EIF3M Blocking Peptide |
| Description | Rabbit polyclonal EIF3M antibody raised against the N terminal of EIF3M |
| Gene | EIF3M |
| Supplier Page | Shop |