| Name | WFDC1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3978 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF |
| Purity/Format | Affinity purified |
| Blocking Peptide | WFDC1 Blocking Peptide |
| Description | Rabbit polyclonal WFDC1 antibody raised against the middle region of WFDC1 |
| Gene | WFDC1 |
| Supplier Page | Shop |