| Name | CYBA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6483 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CYBA antibody was raised using the middle region of CYBA corresponding to a region with amino acids TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP |
| Purity/Format | Affinity purified |
| Blocking Peptide | CYBA Blocking Peptide |
| Description | Rabbit polyclonal CYBA antibody raised against the middle region of CYBA |
| Gene | CYBA |
| Supplier Page | Shop |