| Name | OTUB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4421 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | OTUB1 antibody was raised using the middle region of OTUB1 corresponding to a region with amino acids KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK |
| Purity/Format | Affinity purified |
| Blocking Peptide | OTUB1 Blocking Peptide |
| Description | Rabbit polyclonal OTUB1 antibody raised against the middle region of OTUB1 |
| Gene | OTUB1 |
| Supplier Page | Shop |