| Name | TBC1D13 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4389 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TBC1D13 antibody was raised using the middle region of TBC1D13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS |
| Purity/Format | Affinity purified |
| Blocking Peptide | TBC1D13 Blocking Peptide |
| Description | Rabbit polyclonal TBC1D13 antibody raised against the middle region of TBC1D13 |
| Gene | TBC1D1 |
| Supplier Page | Shop |