| Name | DBT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2499 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW |
| Purity/Format | Affinity purified |
| Blocking Peptide | DBT Blocking Peptide |
| Description | Rabbit polyclonal DBT antibody raised against the N terminal of DBT |
| Gene | DBT |
| Supplier Page | Shop |