| Name | GUSB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1858 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | GUSB Blocking Peptide |
| Description | Rabbit polyclonal GUSB antibody raised against the C terminal of GUSB |
| Gene | GUSB |
| Supplier Page | Shop |